PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G017400.8.p
Common NameGLYMA_04G017400, LOC100790922
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 909aa    MW: 100821 Da    PI: 5.9215
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G017400.8.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.23.8e-29592643152
               RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  Glyma.04G017400.8.p 592 AEKTITLQVLRQYFAGSLKDAAKNIGVCTTTLKRICRQHGIKRWPSRKIKKV 643
                          589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.803582663IPR003035RWP-RK domain
PfamPF020426.4E-25595643IPR003035RWP-RK domain
SuperFamilySSF542771.08E-23814899No hitNo description
SMARTSM006662.8E-25814897IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.2E-22814894No hitNo description
PROSITE profilePS5174527.102814897IPR000270PB1 domain
CDDcd064073.44E-43815896No hitNo description
PfamPF005648.7E-19815896IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 909 aa     Download sequence    Send to blast
MGDSGVTSSA ATMMEAPPPD GTTTTATSMD FDYMGEFFLD GCWLEASADV SDFLLQSPSF  60
SNPLFDPSLS WPALETNHNK SQDAAFGTQQ ESHNNIVSVV AGGGYSQQFQ SETHSVEGVS  120
EGVRRWWFAP SPIPSPGPGP SIMEKLIRAL MWIKDYNRNK DMLIQIWVPI HKEGRPILAA  180
DDLLFSLESK SLNLAKYREI SVTYEFSAEE SDSKELARGL PGRVFRYKVP EWTPDVRFFR  240
SDEYPRVDHA QEYDVRGTVA VPIFEQGSKT CLGVIEVVMT TQQINYGPEL ESVCKALEAV  300
DLRSSKQLSI QNVKQACNRT YEAALPEIYE VLRSACEMHR LPLAQTWVPC VQQGKEGCRH  360
SEDNYLLCIS PVEHACYVGD PSIRSFHEAC TEHHLLKGEG VAGGAFMTNQ PCFSDDITSL  420
SKKDYPLSHY ARLFGLHAAV AIRLRSIYNS TDDFVLEFFL PVDCNDSEEQ RKMLTALSII  480
IQRVCRSLRV IRDKELEEAN LSVDEVIALA DSGFARNAIF SEPQYKGMVA SLDAEEKSSE  540
TMGRKFSDLR QQQESPILKG NLDCVKECST SVEGNLSSLG TNKTGERRRA KAEKTITLQV  600
LRQYFAGSLK DAAKNIGVCT TTLKRICRQH GIKRWPSRKI KKVGHSLQKL QLVINSVQGA  660
SGAFQIGSFY SNFPDLASPN LSGTGFFSTL NQSDYPNSTS TQPDHGSLSP EGASKSPSSS  720
CSQSSISSHS CSSMSELQQH RTANGAGNKV STTVSEDSAG VVLKRISSEA ELKSLSQDRA  780
KLLPRSQSQE TLGEHPKTQY QQPLLKTSSS KVDSHRVKVA YGDEKTRFRM PKSWGYEDLL  840
QEIARRFNVS DMSKFDVKYL DDDCEWVLLT CDADLEECID VCQSSESGTI KLSLQPSSHS  900
MRSSLEFR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.283390.0root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353870.0AC235387.1 Glycine max strain Williams 82 clone GM_WBb0115J10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006577938.10.0PREDICTED: protein NLP4-like isoform X1
RefseqXP_014629894.10.0PREDICTED: protein NLP4-like isoform X1
RefseqXP_006577939.10.0PREDICTED: protein NLP4-like isoform X1
RefseqXP_003523077.10.0PREDICTED: protein NLP4-like isoform X1
RefseqXP_006577937.10.0PREDICTED: protein NLP4-like isoform X1
RefseqXP_006577935.10.0PREDICTED: protein NLP4-like isoform X1
RefseqXP_006577936.10.0PREDICTED: protein NLP4-like isoform X1
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLK7KHM70.0K7KHM7_SOYBN; Uncharacterized protein
STRINGGLYMA04G01910.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein